제품 > 항체 > 단일클론항체(mAb)

Urotensin II (UTS2) Rabbit mAb (A23164)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Rat

Western blot analysis of lysates from Rat brain, using Urotensin II (UTS2) Rabbit mAb (A23164) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	Urotensin II (UTS2) Rabbit mAb
Catalog No.	A23164
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59263

Background

This gene encodes a mature peptide that is an active cyclic heptapeptide absolutely conserved from lamprey to human. The active peptide acts as a vasoconstrictor and is expressed only in brain tissue. Despite the gene family name similarity, this gene is not homologous to urocortin, a member of the sauvagine/corticotropin-releasing factor/urotensin I family. Most of the proprotein is cleaved to make the mature peptide. Transcript variants encoding different preproprotein isoforms have been described for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 20-124 of human Urotensin II (UTS2). (NP_006777.1).
Sequence	SLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
Gene ID
Swiss Prot
Synonyms	UII; U-II; UCN2; PRO1068; Urotensin II (UTS2)
Calculated MW	14kDa
Observed MW	16kDa

Applications

Reactivity	Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Rat brain
Cellular location	Secreted