제품 > 항체 > 다중클론항체(pAb)

VAMP4 Rabbit pAb (A4241)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using VAMP4 antibody (A4241) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	VAMP4 Rabbit pAb
Catalog No.	A4241
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human VAMP4 (NP_003753.2).
Sequence	MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCK
Gene ID
Swiss Prot
Synonyms	VAMP-4; VAMP24
Calculated MW	16kDa
Observed MW	16kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	B cells, HeLa, Jurkat, BT-474, NIH/3T3, Mouse brain, Mouse lung, Rat brain
Cellular location	Golgi apparatus, Single-pass type IV membrane protein, trans-Golgi network membrane
Customer validation	WB(Sus scrofa)