제품 > 항체 > 단일클론항체(mAb)

WAPL Rabbit mAb (A5923)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using WAPL Rabbit mAb (A5923) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts of C2C12 cells, using WAPL Rabbit mAb (A5923) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - WAPL Rabbit mAb (A5923)

Immunofluorescence analysis of HeLa cells using WAPL Rabbit mAb (A5923) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using WAPL Rabbit mAb (A5923) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	WAPL Rabbit mAb
Catalog No.	A5923
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2088

Background

Involved in several processes, including negative regulation of DNA replication; negative regulation of chromatin binding activity; and regulation of sister chromatid cohesion. Located in several cellular components, including Golgi apparatus; intercellular bridge; and microtubule cytoskeleton.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WAPL (Q7Z5K2).
Sequence	MTSRFGKTYSRKGGNGSSKFDEVFSNKRTTLSTKWGETTFMAKLGQKRPNFKPDIQEIPKKPKVEEESTGDPFGFDSDDESLPVSSKNLAQVKCSSYSES
Gene ID
Swiss Prot
Synonyms	FOE; WAPAL; KIAA0261
Calculated MW	133kDa
Observed MW	150kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, RD, Jurkat, C2C12
Cellular location	cytoplasm, cytosol, intercellular bridge, mitotic spindle, nucleoplasm, nucleus