제품 > 항체 > 다중클론항체(pAb)

WBP11 Rabbit pAb (A16191)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using WBP11 Rabbit pAb (A16191) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - WBP11 Rabbit pAb (A16191)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using WBP11 Rabbit pAb (A16191) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse lung using WBP11 Rabbit pAb (A16191) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat liver using WBP11 Rabbit pAb (A16191) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - WBP11 Rabbit pAb (A16191)

Immunofluorescence analysis of NIH/3T3 cells using WBP11 Rabbit pAb (A16191) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using WBP11 Rabbit pAb (A16191) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	WBP11 Rabbit pAb
Catalog No.	A16191
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 540-641 of human WBP11 (NP_057396.1).
Sequence	LIQRPKADDTSAATIEKKATATISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKSEDDSAVPLAKAAPKSGPSVPVSVQTKDDVYEAFMKEMEGLL
Gene ID
Swiss Prot
Synonyms	BUG13; FAP90; NPWBP; SIPP1; VCTRL; CFAP90; VCTERL; WBP-11; PPP1R165; WBP11
Calculated MW	70kDa
Observed MW	115kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	RD, Mouse testis
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Mus musculus, Homo sapiens)