Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Zip12 Rabbit pAb |
---|---|
Catalog No. | A16006 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC39A12 (NP_001138667.1). |
---|---|
Sequence | MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGG |
Gene ID | |
Swiss Prot | |
Synonyms | ZIP12; ZIP-12; LZT-Hs8; bA570F3.1; Zip12 |
Calculated MW | 77kDa |
Observed MW | 77kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, mouse brain, mouse eye, mouse lung, rat brain |
Cellular location | extracellular vesicle, perinuclear region of cytoplasm, plasma membrane |
Customer validation | WB(Rattus norvegicus) IHC(Rattus norvegicus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16006? Please let us know so that we can cite the reference in this datasheet.