제품 > 항체 > 단일클론항체(mAb)

eIF3e Rabbit mAb (A3431)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using eIF3e Rabbit mAb (A3431) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - eIF3e Rabbit mAb (A3431)

Immunohistochemistry analysis of paraffin-embedded mouse testis using eIF3e Rabbit mAb (A3431) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	eIF3e Rabbit mAb
Catalog No.	A3431
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1997

Background

Enables protein N-terminus binding activity. Contributes to translation initiation factor activity. Involved in positive regulation of mRNA binding activity; regulation of gene expression; and translational initiation. Located in cytosol and nucleus. Part of eukaryotic translation initiation factor 3 complex. Colocalizes with PML body.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 210-350 of human eIF3e (P60228).
Sequence	QRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQC
Gene ID
Swiss Prot
Synonyms	INT6; EIF3S6; EIF3-P48; eIF3-p46; eIF3e
Calculated MW	52kDa
Observed MW	48kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, 293T, Jurkat, Mouse lung, Mouse testis, Rat lung, Rat testis
Cellular location	Cytoplasm, Nucleus, PML body
Customer validation	WB(Homo sapiens) IP(Homo sapiens)