Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | hnRNP E2/PCBP2 Rabbit mAb |
---|---|
Catalog No. | A21119 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2994 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-350aa of human hnRNP E2/PCBP2 (NP_001122383.1) |
---|---|
Sequence | PDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYL |
Gene ID | |
Swiss Prot | |
Synonyms | HNRPE2; HNRNPE2; hnRNP-E2; hnRNP E2/PCBP2 |
Calculated MW | 39kDa |
Observed MW | 35-45kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | HeLa, MCF7, Jurkat, C6, C2C12, Mouse liver, Rat testis |
Cellular location | Cytoplasm, Nucleus. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.