제품 > 항체 > 단일클론항체(mAb)

von Willebrand factor (VWF) Rabbit mAb (A13523)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

ABclonal:Western blot - von Willebrand factor (VWF) Rabbit mAb (A13523)

Western blot analysis of lysates from Mouse liver, using von Willebrand factor (VWF) Rabbit mAb (A13523) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - von Willebrand factor (VWF) Rabbit mAb (A13523)

Immunohistochemistry analysis of paraffin-embedded Human esophageal using von Willebrand factor (VWF) Rabbit mAb (A13523) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	von Willebrand factor (VWF) Rabbit mAb
Catalog No.	A13523
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0716

Background

This gene encodes a glycoprotein involved in hemostasis. The encoded preproprotein is proteolytically processed following assembly into large multimeric complexes. These complexes function in the adhesion of platelets to sites of vascular injury and the transport of various proteins in the blood. Mutations in this gene result in von Willebrand disease, an inherited bleeding disorder. An unprocessed pseudogene has been found on chromosome 22.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1150-1300 of human von Willebrand factor (VWF) (P04275).
Sequence	APACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCEVAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVEDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFV
Gene ID
Swiss Prot
Synonyms	VWD; F8VWF; von Willebrand factor (VWF)
Calculated MW	309kDa
Observed MW	309kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse liver
Cellular location	Secreted, extracellular matrix, extracellular space.
Customer validation	WB(Homo sapiens)