제품 > 항체 > 단일클론항체(mAb)

14-3-3 Theta Rabbit mAb (A8936)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using 14-3-3 Theta Rabbit mAb (A8936) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - 14-3-3 Theta Rabbit mAb (A8936)

Immunofluorescence analysis of NIH-3T3 cells using 14-3-3 Theta Rabbit mAb (A8936) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	14-3-3 Theta Rabbit mAb
Catalog No.	A8936
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1358

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 Theta (P27348).
Sequence	MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL
Gene ID
Swiss Prot
Synonyms	1C5; HS1; 14-3-3
Calculated MW	28kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	C6, U-251MG, Mouse testis, Mouse brain, Rat testis
Cellular location	Cytoplasm
Customer validation	WB(Mus musculus)