제품 > 항체 > 단일클론항체(mAb)

14-3-3 beta/zeta Rabbit mAb (A9152)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using 14-3-3 beta/zeta Rabbit mAb (A9152) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - 14-3-3 beta/zeta Rabbit mAb (A9152)

Immunofluorescence analysis of NIH-3T3 cells using 14-3-3 beta/zeta Rabbit mAb (A9152) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	14-3-3 beta/zeta Rabbit mAb
Catalog No.	A9152
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1454

Background

This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 beta/zeta (P31946).
Sequence	MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVL
Gene ID
Swiss Prot
Synonyms	GW128; HEL-S-1; HS1; KCIP-1; YWHAA; 14-3-3
Calculated MW	28kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HT-29, A-549, NIH/3T3, Jurkat, Mouse lung, Mouse kidney, Rat spleen
Cellular location	cytoplasm, cytosol, extracellular exosome, focal adhesion, melanosome, perinuclear region of cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

14-3-3 beta/zeta Rabbit mAb images

Western blot - 14-3-3 beta/zeta Rabbit mAb (A9152)

Immunofluorescence - 14-3-3 beta/zeta Rabbit mAb (A9152)

Immunofluorescence analysis of NIH-3T3 cells using 14-3-3 beta/zeta Rabbit mAb (A9152) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.