제품 > 항체 > 단일클론항체(mAb)

14-3-3 gamma Rabbit mAb (A9162)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using 14-3-3 gamma Rabbit mAb (A9162) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - 14-3-3 gamma Rabbit mAb (A9162)

Immunohistochemistry analysis of paraffin-embedded Mouse brain using 14-3-3 gamma Rabbit mAb (A9162) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	14-3-3 gamma Rabbit mAb
Catalog No.	A9162
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1457

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human 14-3-3 gamma (P61981).
Sequence	VLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA
Gene ID
Swiss Prot
Synonyms	DEE56; EIEE56; PPP1R170; 14-3-3GAMMA; 14-3-3 gamma
Calculated MW	28kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, NIH/3T3, Jurkat, Mouse liver, Mouse heart, Rat lung
Cellular location	Cytoplasm
Customer validation	IHC(Homo sapiens)