Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | ABCB4 Rabbit pAb |
---|---|
Catalog No. | A9835 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ABCB4 (NP_061337.1). |
---|---|
Sequence | MDLEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQDKLFMSLGTIMAIAHGSGLPLMMIVFGEMTDKFVDTAGNFSFPVNFSLSLLNPGKILE |
Gene ID | |
Swiss Prot | |
Synonyms | GBD1; ICP3; MDR2; MDR3; PGY3; ABC21; MDR2/3; PFIC-3 |
Calculated MW | 142kDa |
Observed MW | 144kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain |
Cellular location | Apical cell membrane, Cell membrane, Cytoplasm, Cytoplasmic vesicle, Membrane raft, Multi-pass membrane protein, clathrin-coated vesicle |
Customer validation | WB(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9835? Please let us know so that we can cite the reference in this datasheet.