Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ABCC5 Rabbit pAb |
---|---|
Catalog No. | A3028 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-179 of human ABCC5 (NP_005679.2). |
---|---|
Sequence | MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRL |
Gene ID | |
Swiss Prot | |
Synonyms | MRP5; SMRP; ABC33; MOATC; MOAT-C; pABC11; EST277145 |
Calculated MW | 161kDa |
Observed MW | 185kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain, Mouse lung, Rat brain |
Cellular location | Membrane, Multi-pass membrane protein |
Customer validation | WB(Mus musculus, Homo sapiens) IHC(Mus musculus) IP(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3028? Please let us know so that we can cite the reference in this datasheet.