Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Arabidopsis thaliana
Product name | ABF3 Rabbit pAb |
---|---|
Catalog No. | A22251 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-360 of Arabidopsis thaliana ABF3 (NP_567949.1). |
---|---|
Sequence | QQPQQLIQTQERPFPKQTTIAFSNTVDVVNRSQPATQCQEVKPSILGIHNHPMNNNLLQAVDFKTGVTVAAVSPGSQMSPDLTPKSALDASLSPVPYMFGR |
Gene ID | |
Swiss Prot | |
Synonyms | abscisic acid responsive elements-binding factor 3; AtABF3; DC3 PROMOTER-BINDING FACTOR 5; DPBF5; F17I5.200; ABF3 |
Calculated MW | |
Observed MW | 50kDa |
Reactivity | Arabidopsis thaliana |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Seedling, Before inflorescence, Rosette leaf |
Cellular location |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.