Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | ABI2 Rabbit pAb |
---|---|
Catalog No. | A14992 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABI2 (NP_001269854.1). |
---|---|
Sequence | HKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRT |
Gene ID | |
Swiss Prot | |
Synonyms | AIP1; ABI-2; ABI2B; AIP-1; AblBP3; argBP1; SSH3BP2; argBPIA; argBPIB; ABI2 |
Calculated MW | 56kDa |
Observed MW | 50kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-251MG, Mouse brain |
Cellular location | Cell projection, Cytoplasm, cytoskeleton, filopodium, lamellipodium |
* For research use only. Not for therapeutic or diagnostic purposes.