Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | ABR Rabbit pAb |
---|---|
Catalog No. | A15635 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ABR (NP_001243776.1). |
---|---|
Sequence | DPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV |
Gene ID | |
Swiss Prot | |
Synonyms | MDB; ABR |
Calculated MW | 98kDa |
Observed MW | 110kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse thymus, Rat lung, Rat spleen |
Cellular location | axon, cytosol, dendritic spine, glutamatergic synapse, Schaffer collateral - CA1 synapse |
* For research use only. Not for therapeutic or diagnostic purposes.