ABflo® 450 Rabbit anti-Human CD22 mAb (A26732)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Flow CytoMetry - ABflo® 450 Rabbit anti-Human CD22 mAb (A26732)

Flow cytometry: 1X10^6 Daudi cells were surface-stained with ABflo® 450 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 450 Rabbit anti-Human CD22 mAb (A26732, 5 μl/Test, right).

Overview

Product name	ABflo® 450 Rabbit anti-Human CD22 mAb
Catalog No.	A26732
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59252-ABflo450

Predicted to enable CD4 receptor binding activity; protein phosphatase binding activity; and sialic acid binding activity. Involved in B cell activation; negative regulation of B cell receptor signaling pathway; and regulation of endocytosis. Located in early endosome and recycling endosome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-687 of human CD22 (NP_001762.2).
Sequence	DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR
Gene ID
Swiss Prot
Synonyms	SIGLEC2; SIGLEC-2
Calculated MW	95kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein, cell surface, cytoplasm, early endosome, external side of plasma membrane, extracellular exosome, plasma membrane, recycling endosome, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 450 Rabbit anti-Human CD22 mAb images

Flow CytoMetry - ABflo® 450 Rabbit anti-Human CD22 mAb (A26732)

Flow cytometry: 1X10^6 Daudi cells were surface-stained with ABflo® 450 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 450 Rabbit anti-Human CD22 mAb (A26732, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.