Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ABflo® 488 Conjugated TOM20 Rabbit mAb |
---|---|
Catalog No. | A26783 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC5002-01-ABflo488 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1). |
---|---|
Sequence | YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE |
Gene ID | |
Swiss Prot | |
Synonyms | MAS20; MOM19; TOM20 |
Calculated MW | 16kDa |
Observed MW | 16kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze. Buffer:PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa, 293T, Mouse brain, Mouse kidney, Rat kidney |
Cellular location | Mitochondrion outer membrane, Single-pass membrane protein, mitochondrial outer membrane, mitochondrion. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.