제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784) at 1:5000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784)

Confocal imaging of HeLa cells using ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784, dilution 1:1000). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of C2C12 cells using ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784, dilution 1:1000). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of paraffin-embedded Rat small intestine tissue using ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784, dilution 1:1000). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Overview

Product name	ABflo® 647 Conjugated TOM20 Rabbit mAb
Catalog No.	A26784
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC5002-01-ABflo647

Background

Enables protein-transporting ATPase activity and unfolded protein binding activity. Involved in protein targeting to mitochondrion. Located in mitochondria-associated endoplasmic reticulum membrane and mitochondrial outer membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1).
Sequence	YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Gene ID
Swiss Prot
Synonyms	MAS20; MOM19; TOM20
Calculated MW	16kDa
Observed MW	16kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:5000 - 1:20000 IF/ICC 1:200 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze. Buffer:PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, 293T, Mouse brain, Mouse kidney, Rat kidney
Cellular location	Mitochondrion outer membrane, Single-pass membrane protein, mitochondrial outer membrane, mitochondrion.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 647 Conjugated TOM20 Rabbit mAb images

Western blot - ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784)

Immunofluorescence - ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784)

Confocal imaging of HeLa cells using ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784, dilution 1:1000). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunofluorescence - ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784)

Confocal imaging of C2C12 cells using ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784, dilution 1:1000). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunofluorescence - ABflo® 647 Conjugated TOM20 Rabbit mAb (A26784)

* For research use only. Not for therapeutic or diagnostic purposes.