제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD35 mAb (A24697)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 REH cells (negative control, left) and Human PBMC (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD35 mAb (A24697, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD35 mAb (A24697, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human CD35 mAb
Catalog No.	A24697
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63486-ABflo488

Background

Complement receptor type 1 (CR1/CD35) is a type I transmembrane glycoprotein that is expressed on the surface of B cells, neutrophils, monocytes, and renal podocytes. As a component of the host's innate immune system, CR1/CD35 expressed on neutrophils and monocytes binds to ligands coated with complement opsonins C3b and C4b, thereby promoting phagocytosis and pro-inflammatory cytokine production. CR1/CD35 also participates in negative regulation of the complement cascade through its ability to promote dissociation of C3 and C5 convertases and by serving as one of multiple cofactors for factor-I-mediated cleavage and inactivation of C3b and C4b.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 901-1095 of human CD35 (NP_000564.2).
Sequence	DPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRC
Gene ID
Swiss Prot
Synonyms	CR1; C3BR; C4BR; CD35; KN; complement receptor type 1
Calculated MW	223kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 488 Rabbit anti-Human CD35 mAb images

Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD35 mAb (A24697)

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD35 mAb (A24697, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.