제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Mouse CD270/HVEM mAb (A27135)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C2C12 cells (negative control, left) and C57BL/6 mouse splenocytes (right) were surface-stained with ABflo® 488 Rabbit anti-Mouse CD270/HVEM mAb (A27135, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse CD270/HVEM mAb (A27135, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Mouse CD270/HVEM mAb
Catalog No.	A27135
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC71587-ABflo488

Background

Predicted to enable cytokine binding activity and ubiquitin protein ligase binding activity. Acts upstream of or within several processes, including defense response to bacterium; negative regulation of alpha-beta T cell proliferation; and positive regulation of macromolecule metabolic process. Located in external side of plasma membrane. Is expressed in liver lobe. Orthologous to human TNFRSF14 (TNF receptor superfamily member 14).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 39-207 of mouse CD270/HVEM (NP_849262.1).
Sequence	QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV
Gene ID
Swiss Prot
Synonyms	TR2; Atar; HveA; Hvem; Tnfrs14
Calculated MW	30kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane.