제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Mouse CD95/FAS mAb (A23810)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 L-929 cells(Low Expression, left) and A20 cells(right) were surface-stained with ABflo® 488 Rabbit anti-Mouse CD95/FAS mAb(A23810, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 A20 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse CD95/FAS mAb(A23810, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Mouse CD95/FAS mAb
Catalog No.	A23810
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61283-ABflo488

Background

CD95, also known as Fas, is a approximately 45 kD type I transmembrane protein in the TNFR superfamily (TNFRSF6). CD95 was expressed in thymus, spleen, liver, heart, lung, ovary and other organs. CD95 binds ligand (FasL) to form a death-inducing signaling complex (DISC) in cells to induce apoptosis. Cd95-induced apoptosis plays an important role in development and in maintaining peripheral tolerance of the immune system.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-169 of mouse CD95/FAS. (NP_032013.2).
Sequence	QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR
Gene ID
Swiss Prot
Synonyms	lpr; APO1; APT1; CD95; TNFR6; Tnfrsf6
Calculated MW	37KDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	cytomembrane、cytoplasm
Customer validation	WB(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 488 Rabbit anti-Mouse CD95/FAS mAb images

Flow CytoMetry - ABflo® 488 Rabbit anti-Mouse CD95/FAS mAb (A23810)

Flow cytometry:1X10^6 A20 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse CD95/FAS mAb(A23810, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.