제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Mouse CXCR2/IL-8RB mAb (A26757)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Mouse CXCR2/IL-8RB mAb (A26757, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse CXCR2/IL-8RB mAb (A26757, 5 μl/Test, right).

Flow cytometry: 1X10^6 RAW264.7 cells (negative control, left) and C57BL/6 mouse bone marrow cells (right) were surface-stained with ABflo® 488 Rabbit anti-Mouse CXCR2/IL-8RB mAb (A26757, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	ABflo® 488 Rabbit anti-Mouse CXCR2/IL-8RB mAb
Catalog No.	A26757
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65373-ABflo488

Background

Enables chemokine receptor activity. Acts upstream of or within negative regulation of apoptotic process. Predicted to be located in several cellular components, including cell surface; mast cell granule; and mitotic spindle. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; embryo mesenchyme; epithelium; and heart. Human ortholog(s) of this gene implicated in IgA glomerulonephritis; acute pyelonephritis; end stage renal disease; and urinary bladder cancer. Orthologous to human CXCR2 (C-X-C motif chemokine receptor 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-44 of mouse CXCR2/IL-8RB (NP_034039.1).
Sequence	MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLE
Gene ID
Swiss Prot
Synonyms	CD128; IL8RA; Il8rb; CDw128; Cmkar2; Gpcr16; IL-8Rh; IL-8rb; mIL-8RH
Calculated MW	40kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane.