제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Mouse FOXP3 mAb (A26228)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry:1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 647 Rabbit anti-Mouse CD4 mAb (A24721, 5 μl/Test) and then intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse FOXP3 mAb (A26228, 5 μl/Test, right).

Review

Overview

Product name	ABflo® 488 Rabbit anti-Mouse FOXP3 mAb
Catalog No.	A26228
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68296-ABflo488

Background

The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene result in the scurfy phenotype (sf). Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Foxp3 (NP_473380.1).
Sequence	MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPH
Gene ID
Swiss Prot
Synonyms	sf; JM2; scurfin
Calculated MW	47kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Nucleus, Cytoplasm.
Customer validation	(293T cells)