제품 > 항체 > 단일클론항체(mAb)

FOXP3 Rabbit mAb (A26210)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with Foxp3 using Foxp3 Rabbit mAb (A26210) at 1:5000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
.Exposure time: 5s.

Western blot analysis of lysates from Mouse thymus using Foxp3 Rabbit mAb (A26210) at 1:5000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

Overview

Product name	FOXP3 Rabbit mAb
Catalog No.	A26210
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68296

Background

The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene result in the scurfy phenotype (sf). Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse FOXP3 (NP_473380.1).
Sequence	MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPH
Gene ID
Swiss Prot
Synonyms	sf; JM2; scurfin
Calculated MW	47kDa
Observed MW	47-55kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:6000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T transfected with FOXP3(M), Mouse thymus
Cellular location	Nucleus, Cytoplasm.
Customer validation	WB(Mus musculus)