제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Mouse/Rat CD27 mAb (A25450)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Flow cytometry: 1X10^6 A20 cells (negative control, left) and C57BL/6 mouse Splenocytes (right) were surface-stained with ABflo® 488 Rabbit anti-Mouse/Rat CD27 mAb (A25450, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse Splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse/Rat CD27 mAb (A25450, 5 μl/Test, right).

Flow cytometry: 1X10^6 Rat Splenocytes were surface-stained with ABflo® 488 Rabbit anti-Mouse/Rat CD27 mAb (A25450, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained Rat Splenocytes were used as blank control (red line).

Flow cytometry: 1X10^6 Rat Splenocytes were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse/Rat CD27 mAb (A25450, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Mouse/Rat CD27 mAb
Catalog No.	A25450
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67086-ABflo488

Background

Predicted to enable cysteine-type endopeptidase inhibitor activity involved in apoptotic process. Involved in negative regulation of apoptotic process and positive regulation of JNK cascade. Acts upstream of or within negative regulation of T cell apoptotic process. Located in external side of plasma membrane. Is expressed in several structures, including femur; hemolymphoid system; intestine; pituitary gland; and reproductive system. Human ortholog(s) of this gene implicated in lymphoproliferative syndrome 2. Orthologous to human CD27 (CD27 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-182 of mouse CD27 (NP_001028298.1).
Sequence	PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR
Gene ID
Swiss Prot
Synonyms	S152; Tp55; Tnfrsf7
Calculated MW	28kDa
Observed MW

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein