제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human CD112/Nectin-2 mAb (A24329)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 MOLT-4 cells (negative control, Left) and MCF-7 cells (Right) were surface-stained with ABflo® 594 Rabbit anti-Human CD112/Nectin-2 mAb(A24329, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 MCF-7 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD112/Nectin-2 mAb(A24329, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human CD112/Nectin-2 mAb
Catalog No.	A24329
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62371-ABflo594

Background

This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	Recombinant Protein corresponding to a sequence within amino acids 32-158 of human CD112/Nectin-2 (NP_001036189.1).
Sequence	QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRV
Gene ID
Swiss Prot
Synonyms	NECTIN2; CD112; HVEB; PRR2; PVRL2; PVRR2; nectin-2
Calculated MW	51kDa/57kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein