제품 > 항체 > 단일클론항체(mAb)

Nectin 2/CD112 Rabbit mAb (A9622)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Nectin 2 Rabbit mAb (A9622) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Nectin 2/CD112 Rabbit mAb (A9622)

Immunohistochemistry analysis of Nectin 2/CD112 in paraffin-embedded rat colon tissue using Nectin 2/CD112 Rabbit mAb (A9622) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Nectin 2/CD112 in paraffin-embedded human colon tissue using Nectin 2/CD112 Rabbit mAb (A9622) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Nectin 2/CD112 in paraffin-embedded mouse testis tissue using Nectin 2/CD112 Rabbit mAb (A9622) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Nectin 2/CD112 in paraffin-embedded human thyroid cancer tissue using Nectin 2/CD112 Rabbit mAb (A9622) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	Nectin 2/CD112 Rabbit mAb
Catalog No.	A9622
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1665

Background

This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 410-538 of human Nectin 2/CD112 (ARC1665).
Sequence	TPKAKLEAQEMPSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPVPPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV
Gene ID
Swiss Prot
Synonyms	HVEB; PRR2; CD112; PVRL2; PVRR2; Nectin 2/CD112
Calculated MW	58kDa
Observed MW	72kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Jurkat, SH-SY5Y
Cellular location	Cell membrane, Single-pass type I membrane protein