제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human LILRA2/CD85h mAb (A25568)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Confocal imaging of 293T cells transfected with LILRA2/CD85h using ABflo® 594 Rabbit anti-Human LILRA2/CD85h mAb (A25568, dilution 1:200). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - ABflo® 594 Rabbit anti-Human LILRA2/CD85h mAb (A25568)

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with ABflo® 594 Rabbit anti-Human LILRA2/CD85h mAb (A25568, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human LILRA2/CD85h mAb (A25568, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human LILRA2/CD85h mAb
Catalog No.	A25568
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65539-ABflo594

Background

This gene encodes a member of a family of immunoreceptors that are expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. The encoded protein is an activating receptor that inhibits dendritic cell differentiation and antigen presentation and suppresses innate immune response. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and there is a pseudogene for this gene on chromosome 3.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-449 of human LILRA2/CD85h (NP_001124389.2).
Sequence	GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVEN
Gene ID
Swiss Prot
Synonyms	ILT1; LIR7; CD85H; LIR-7
Calculated MW	53kDa/51kDa/48kDa/47kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Membrane, Secreted, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구면역학 & 염증CDs

ABflo® 594 Rabbit anti-Human LILRA2/CD85h mAb images

Immunofluorescence - ABflo® 594 Rabbit anti-Human LILRA2/CD85h mAb (A25568)

Confocal imaging of 293T cells transfected with LILRA2/CD85h using ABflo® 594 Rabbit anti-Human LILRA2/CD85h mAb (A25568, dilution 1:200). DAPI was used for nuclear staining (Blue). Objective: 100x.

Flow CytoMetry - ABflo® 594 Rabbit anti-Human LILRA2/CD85h mAb (A25568)

* For research use only. Not for therapeutic or diagnostic purposes.