제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human Nectin-4 mAb (A25194)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HAP1 cells (negative control, left) and T-47D cells (right) were surface-stained with ABflo® 594 Rabbit anti-Human Nectin-4 mAb (A25194, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 T-47D cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human Nectin-4 mAb (A25194, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human Nectin-4 mAb
Catalog No.	A25194
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66068-ABflo594

Background

Nectin-4/ poliovirus Receptor-like 4 (PVRL4) is a type I transmembrane glycoprotein belonging to the immunoglobulin superfamily that promotes intercellular adhesion by acting as a major component of adhesion junctions. The extracellular domain of Nectin-4 consists of one Ig variable region (V) and two Ig constant regions (C), which mediate binding to measles virus and adjacent cells through trans-heterophile interactions with Nectin-1. Unlike other members of the connectin family, which are widely expressed in adult tissues, human Nectin-4 expression is largely limited to the blastoderm. Studies have shown that Nectin-4 is overexpressed in cells from a variety of human solid tumors, including pancreatic, breast, lung, and ovarian cancers. The expression pattern of Nectin-4 in normal tissues is limited, so NECTIN-4 can be used as a novel therapeutic target for various human tumors.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 32-146 of human Nectin-4 (NP_112178.2).
Sequence	GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVL
Gene ID
Swiss Prot
Synonyms	LNIR; PRR4; EDSS1; PVRL4; nectin-4
Calculated MW	24kDa/55kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell junction, cell membrane, secreted, single-pass type I membrane protein, adherens junction