제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Mouse CD11b mAb (A24096)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C57BL/6 mouse bone marrow cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD11b mAb (A24096, 5 μl/Test, right).

Review

Overview

Product name	ABflo® 594 Rabbit anti-Mouse CD11b mAb
Catalog No.	A24096
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63899-ABflo594

Background

Enables complement component C3b binding activity; heparan sulfate proteoglycan binding activity; and heparin binding activity. Contributes to cargo receptor activity. Involved in several processes, including central nervous system development; endocytosis; and positive regulation of neuron death. Acts upstream of or within several processes, including activated T cell proliferation; leukocyte migration; and microglia development. Located in external side of plasma membrane and nucleus. Is integral component of membrane. Part of integrin alphaM-beta2 complex. Is expressed in several structures, including central nervous system; heart; lymphatic vessel; thymus; and yolk sac. Human ortholog(s) of this gene implicated in lupus nephritis. Orthologous to human ITGAM (integrin subunit alpha M).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 143-337 of mouse CD11b (NP_032427.2).
Sequence	ECPQQESDIVFLIDGSGSINNIDFQKMKEFVSTVMEQFKKSKTLFSLMQYSDEFRIHFTFNDFKRNPSPRSHVSPIKQLNGRTKTASGIRKVVRELFHKTNGARENAAKILVVITDGEKFGDPLDYKDVIPEADRAGVIRYVIGVGNAFNKPQSRRELDTIASKPAGEHVFQVDNFEALNTIQNQLQEKIFAIEG
Gene ID
Swiss Prot
Synonyms	CR3; CR3A; MAC1; Cd11b; Ly-40; Mac-1; Mac-1a; CD11b/CD18; F730045J24Rik
Calculated MW	127kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Membrane raft
Customer validation	(RAW264.7 cells)