제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Mouse CD138/Syndecan-1 mAb (A24155)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 CHO (Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD138/Syndecan-1 mAb (A24155, 5 μl/Test, right).

Flow cytometry: 1X10^6 CHO cells (negative control, left) and CHO (Transfection, right) cells were surface-stained with ABflo® 594 Rabbit anti-Mouse CD138/Syndecan-1 mAb (A24155, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	ABflo® 594 Rabbit anti-Mouse CD138/Syndecan-1 mAb
Catalog No.	A24155
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66008-ABflo594

Background

Predicted to enable identical protein binding activity and protein C-terminus binding activity. Involved in myoblast development. Acts upstream of or within canonical Wnt signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; egg cylinder; sensory organ; skin; and urinary system. Orthologous to human SDC1 (syndecan 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 23-255 of mouse CD138/Syndecan-1 (NP_035649.1).
Sequence	QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKEVLG
Gene ID
Swiss Prot
Synonyms	Sstn; Synd; CD138; Synd1; syn-1
Calculated MW	33kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein, Secreted