제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Mouse CD262/TRAILR2 mAb (A24376)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry:1X10^6 293F cells (negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 594 Rabbit anti-Mouse CD262/TRAILR2 mAb(A24376, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD262/TRAILR2 mAb(A24376, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Mouse CD262/TRAILR2 mAb
Catalog No.	A24376
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62153-ABflo594

Background

Predicted to enable TRAIL receptor activity; identical protein binding activity; and protease binding activity. Predicted to be involved in TRAIL-activated apoptotic signaling pathway and positive regulation of apoptotic process. Predicted to act upstream of or within apoptotic process and regulation of apoptotic process. Predicted to be located in Golgi apparatus; cytosol; and membrane raft. Predicted to be active in cell surface and plasma membrane. Is expressed in bladder; liver; renal vasculature; urethra of female; and urethra of male. Human ortholog(s) of this gene implicated in carcinoma (multiple); cervical cancer; hematologic cancer (multiple); and urinary bladder cancer. Orthologous to several human genes including TNFRSF10A (TNF receptor superfamily member 10a).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 53-170 of mouse CD262/TRAILR2( NP_064671.2).
Sequence	NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCV
Gene ID
Swiss Prot
Synonyms	MK; DR5; Ly98; KILLER; TRICKB; TRAILR2; TRICK2A; TRICK2B
Calculated MW	42kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein