제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Mouse CD97 mAb (A23823)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 NTERA-2 cells (negative control, left) and C57BL/6 mouse Splenocytes (right) were surface-stained with ABflo® 594 Rabbit anti-Mouse CD97 mAb(A23823, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse Splenocytes cells were surface-stained with with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD97 mAb(A23823, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Mouse CD97 mAb
Catalog No.	A23823
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62048-ABflo594

Background

Predicted to enable G protein-coupled receptor activity and chondroitin sulfate binding activity. Acts upstream of or within positive regulation of synapse assembly. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system; eye; genitourinary system; gut; and immune system. Human ortholog(s) of this gene implicated in vibratory urticaria. Orthologous to several human genes including ADGRE5 (adhesion G protein-coupled receptor E5).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-265 of mouse CD97(NP_036055.2).
Sequence	QKAESKNCAKWCPINSKCVSNRSCVCKPGFSSEKELITNPAESCEDINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQASVNTGTTPVPSRIHTVTTAPGNLPEQTTTVHQTQMGDSEERTPKDVNECISGQNHCHQSTHCINKLGGYSCICRQGWKPVPGSPNGPVSTVCEDVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRGPDTICQEPPF
Gene ID
Swiss Prot
Synonyms	Cd97; TM7LN1
Calculated MW	90KDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location