제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Mouse VISTA PolymAb® (A25975PM)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 NIH/3T3 cells (negative control, left) and C57BL/6 mouse splenocytes (right) were surface-stained with ABflo® 594 Rabbit anti-Mouse VISTA PolymAb® (A25975PM, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse VISTA PolymAb® (A25975PM, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Mouse VISTA PolymAb®
Catalog No.	A25975PM
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable endopeptidase activator activity; enzyme binding activity; and identical protein binding activity. Acts upstream of or within several processes, including negative regulation of CD4-positive, alpha-beta T cell proliferation; negative regulation of T cell cytokine production; and positive regulation of BMP signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including heart; immune system; lung; male reproductive gland or organ; and small intestine lamina propria. Orthologous to human VSIR (V-set immunoregulatory receptor).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 33-191 of mouse VISTA (NP_083008.1).
Sequence	FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA
Gene ID
Swiss Prot
Synonyms	Dies1; PD-1H; VISTA; 4632428N05Rik
Calculated MW	34kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane; Single-pass type I membrane protein.