제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb (A23222)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 293F cells (negative control, Left) and HEL cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 HEL cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb(A23222, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human CD120b/TNFRSF1B mAb
Catalog No.	A23222
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57370-ABf647

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 23-257 of human CD120b/TNFRSF1B (NP_001057.1).
Sequence	LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Gene ID
Swiss Prot
Synonyms	p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II
Calculated MW	28kDa/48kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Extracellular region, membrane, membrane raft, neuronal cell body, nucleus, perinuclear region of cytoplasm, plasma membrane