Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TNFR2/TNFRSF1B Rabbit mAb |
---|---|
Catalog No. | A19127 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0397 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 362-461 of human TNFR2/TNFRSF1B (P20333). |
---|---|
Sequence | RASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQVPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS |
Gene ID | |
Swiss Prot | |
Synonyms | p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II; TNFR2/TNFRSF1B |
Calculated MW | 48kDa |
Observed MW | 68kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SW620, 293T, K-562, Mouse spleen, Rat liver |
Cellular location | Cell membrane, Secreted, Single-pass type I membrane protein. |
Customer validation | (293T、HeLa、Jurkat、HepG2、RPMI-8226、PC-3、MOLT-4、K-562, PC-3 HEPG2 HELA MOLT4 A549 JURKAT 293T RPMI-8226) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr