제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human CD300F/IREM-1 mAb (A24705)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 K-562 cells (negative control, left) and Human PBMC (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD300F/IREM-1 mAb (A24705, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD300F/IREM-1 mAb (A24705, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human CD300F/IREM-1 mAb
Catalog No.	A24705
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63892-ABflo647

Background

This gene encodes a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. The encoded protein is an inhibitory receptor. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-156 of human CD300F/IREM-1 (NP_620587.2).
Sequence	TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
Gene ID
Swiss Prot
Synonyms	CD300LF; CD300f; CLM-1; CLM1; IREM-1; IREM1; IgSF13; LMIR3; NKIR; CMRF35-like molecule 1
Calculated MW	18kDa/21kDa/26kDa/32kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, single-pass type I membrane protein