제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human CD352/SLAMF6 mAb (A23799)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HAP1 cells(negative control, left) and Daudi cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD352/SLAMF6 mAb(A23799, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD352/SLAMF6 mAb(A23799, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human CD352/SLAMF6 mAb
Catalog No.	A23799
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60903-ABflo647

Background

The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It functions as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-215 of human CD352/SLAMF6 (NP_001171643.1)
Sequence	SLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCE
Gene ID
Swiss Prot
Synonyms	SLAMF6; CD352; KALI; KALIb; Ly108; NTB-A; NTBA; SF2000; SLAM family member 6
Calculated MW	24kDa/37kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein.