제품 > 항체 > 단일클론항체(mAb)

CD352/SLAMF6 Rabbit mAb (A23833)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using CD352/SLAMF6 Rabbit mAb (A23833) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - CD352/SLAMF6 Rabbit mAb (A23833)

Immunohistochemistry analysis of paraffin-embedded Human tonsil using CD352/SLAMF6 Rabbit mAb (A23833) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Flow CytoMetry - CD352/SLAMF6 Rabbit mAb (A23833)

Flow cytometry: 1X10^6 HAP1 cells(negative control, left) and Daudi cells(right) were surface-stained with CD352/SLAMF6 Rabbit mAb(A23833, 2μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb (1:200 dilution) staining.Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or CD352/SLAMF6 Rabbit mAb(A23833, 2 μg/mL, right).

Overview

Product name	CD352/SLAMF6 Rabbit mAb
Catalog No.	A23833
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60903

Background

The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It functions as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-215 of human CD352/SLAMF6 (NP_001171643.1)
Sequence	SLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCE
Gene ID
Swiss Prot
Synonyms	SLAMF6; CD352; KALI; KALIb; Ly108; NTB-A; NTBA; SF2000; SLAM family member 6; CD352/SLAMF6
Calculated MW	24kDa/37kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:200 - 1:800 FC 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Flow Cytometry
Positive samples	Ramos, Daudi
Cellular location	Cell membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구면역학 & 염증CDs

CD352/SLAMF6 Rabbit mAb images

Western blot - CD352/SLAMF6 Rabbit mAb (A23833)

Immunohistochemistry - CD352/SLAMF6 Rabbit mAb (A23833)

Flow CytoMetry - CD352/SLAMF6 Rabbit mAb (A23833)

Flow cytometry:1X10^6 Daudi cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or CD352/SLAMF6 Rabbit mAb(A23833, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.