제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human CD97 mAb (A22501)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 MOLT-4 cells (Low Expression, left) and U-937 cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD97 mAb (A22501, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 U-937 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD97 mAb (A22501, 5 μl/Test, right).

Flow cytometry: 1X10^6 MOLT-4 cells (Low Expression) were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD97 mAb (A22501, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit anti-Human CD97 mAb (A22501, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained Human PBMC was used as blank control (red line).

Flow cytometry: 1X10^6 Human PBMC cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD97 mAb (A22501, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human CD97 mAb
Catalog No.	A22501
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55825-ABf647

Background

This gene encodes a member of the EGF-TM7 subfamily of adhesion G protein-coupled receptors, which mediate cell-cell interactions. These proteins are cleaved by self-catalytic proteolysis into a large extracellular subunit and seven-span transmembrane subunit, which associate at the cell surface as a receptor complex. The encoded protein may play a role in cell adhesion as well as leukocyte recruitment, activation and migration, and contains multiple extracellular EGF-like repeats which mediate binding to chondroitin sulfate and the cell surface complement regulatory protein CD55. Expression of this gene may play a role in the progression of several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms with 3 to 5 EGF-like repeats have been observed for this gene. This gene is found in a cluster with other EGF-TM7 genes on the short arm of chromosome 19.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-398 of human CD97 (NP_510966.1).
Sequence	QDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAV
Gene ID
Swiss Prot
Synonyms	CD97; TM7LN1
Calculated MW	92kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Extracellular exosome, Focal adhesion, Plasma membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 647 Rabbit anti-Human CD97 mAb images

Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD97 mAb (A22501)

Flow cytometry: 1X10^6 U-937 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD97 mAb (A22501, 5 μl/Test, right).

Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD97 mAb (A22501)

* For research use only. Not for therapeutic or diagnostic purposes.