제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human GSK3β mAb (A26726)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 knockout (KO) HeLa cells (negative control, left) and HeLa cells (right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human GSK3β mAb (A26726, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 HeLa cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human GSK3β mAb (A26726, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Human GSK3β mAb
Catalog No.	A26726
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC70827-ABflo647

Background

The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction, and apoptotic pathways. Defects in this gene have been associated with Parkinson disease and Alzheimer disease.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 321-420 of human GSK3β (NP_001139628.1).
Sequence	LEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Gene ID
Swiss Prot
Synonyms	GSK3B
Calculated MW	47kDa
Observed MW	GSK3B; glycogen synthase kinase-3 beta; GSK3β

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Cell membrane, Cytoplasm, Nucleus.