제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse CD205/DEC-205 mAb (A25531)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 RAW 264.7 cells (negative control, left) and C57BL/6 mouse bone marrow cells (right) were surface-stained with ABflo® 647 Rabbit anti-Mouse CD205/DEC-205 mAb (A25531, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse bone marrow cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μL/Test, left) or ABflo® 647 Rabbit anti-Mouse CD205/DEC-205 mAb (A25531, 5 μL/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Mouse CD205/DEC-205 mAb
Catalog No.	A25531
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65551-ABflo647

Background

Predicted to enable signaling receptor activity. Predicted to act upstream of or within endocytosis. Located in external side of plasma membrane. Is expressed in thymus and thymus primordium. Orthologous to several human genes including LY75-CD302 (LY75-CD302 readthrough).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 216-490 of mouse CD205/DEC-205 (NP_038853.2).
Sequence	CEGNWEKNEQIGSCYQFNNQEILSWKEAYVSCQNQGADLLSIHSAAELAYITGKEDIARLVWLGLNQLYSARGWEWSDFRPLKFLNWDPGTPVAPVIGGSSCARMDTESGLWQSVSCESQQPYVCKKPLNNTLELPDVWTYTDTHCHVGWLPNNGFCYLLANESSSWDAAHLKCKAFGADLISMHSLADVEVVVTKLHNGDVKKEIWTGLKNTNSPALFQWSDGTEVTLTYWNENEPSVPFNKTPNCVSYLGKLGQWKVQSCEKKLRYVCKKKGE
Gene ID
Swiss Prot
Synonyms	CD205; DEC205; DEC-205
Calculated MW	197kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane