제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse CD23 mAb (A23851)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C57BL/6 mouse Splenocytes were surface-stained with ABflo® 647 Rabbit anti-Mouse CD23 mAb(A23851, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained C57BL/6 mouse Splenocytes cells were used as blank control (red line).

Flow cytometry: 1X10^6 HEL cells(negative control) were surface-stained with ABflo® 647 Rabbit anti-Mouse CD23 mAb(A23851, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained HEL cells were used as blank control (red line).

Flow cytometry:1X10^6 C57BL/6 mouse Splenocytes were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD23 mAb(A23851, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Mouse CD23 mAb
Catalog No.	A23851
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60396-ABf647

Background

Predicted to enable carbohydrate binding activity. Acts upstream of or within positive regulation of humoral immune response mediated by circulating immunoglobulin. Located in external side of plasma membrane. Orthologous to human FCER2 (Fc fragment of IgE receptor II).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 50-331 of mouse CD23 (NP_038545.1).
Sequence	ETEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP
Gene ID
Swiss Prot
Synonyms	CD23; Fce2; Fcer2; Ly-42
Calculated MW	37KDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type II membrane protein