제품 > 항체 > 단일클론항체(mAb)

CD23 Rabbit mAb (A23376)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using CD23 Rabbit mAb (A23376) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	CD23 Rabbit mAb
Catalog No.	A23376
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60396

Background

Predicted to enable carbohydrate binding activity. Acts upstream of or within positive regulation of humoral immune response mediated by circulating immunoglobulin. Located in external side of plasma membrane. Orthologous to human FCER2 (Fc fragment of IgE receptor II).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 50-331 of mouse CD23 (NP_038545.1).
Sequence	ETEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP
Gene ID
Swiss Prot
Synonyms	CD23; Fce2; Fcer2; Ly-42
Calculated MW	38kDa
Observed MW	46kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Daudi, Mouse spleen, Mouse testis
Cellular location