제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse CD59a mAb (A23362)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry:1X10^6 293F cells(negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Mouse CD59a mAb(A23362, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line).Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD59a mAb(A23362, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Mouse CD59a mAb
Catalog No.	A23362
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57958-ABf647

Background

Predicted to enable complement binding activity. Involved in several processes, including negative regulation of angiogenesis; negative regulation of fibroblast growth factor production; and negative regulation of vascular endothelial growth factor receptor signaling pathway. Acts upstream of or within negative regulation of activation of membrane attack complex. Located in external side of plasma membrane. Is expressed in several structures, including Meckel's cartilage; nervous system; neural retina; skeleton; and testis. Human ortholog(s) of this gene implicated in colorectal carcinoma and ovarian cancer. Orthologous to human CD59 (CD59 molecule (CD59 blood group)).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-96 of mouse CD59a (NP_031678.1).
Sequence	LTCYHCFQPVVSSCNMNSTCSPDQDSCLYAVAGMQVYQRCWKQSDCHGEIIMDQLEETKLKFRCCQFNLCNKS
Gene ID
Swiss Prot
Synonyms	Cd59; MACIF; MAC-IP
Calculated MW	14kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell surface, external side of plasma membrane, extracellular space, plasma membrane