제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse CD62L mAb (A26716)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 NIH/3T3 cells (negative control, left) and C57BL/6 mouse splenocytes (right) were surface-stained with ABflo® 647 Rabbit anti-Mouse CD62L mAb (A26716, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse CD62L mAb (A26716, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Mouse CD62L mAb
Catalog No.	A26716
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC69898-ABflo647

Background

Enables cell adhesion molecule binding activity. Acts upstream of or within response to ATP. Located in external side of plasma membrane. Is expressed in brain; brainstem; submandibular gland epithelium; and testis. Used to study type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in Crohn's disease; IgA glomerulonephritis; and ulcerative colitis. Orthologous to human SELL (selectin L).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 39-332 of mouse CD62L (NP_035476.1).
Sequence	WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN
Gene ID
Swiss Prot
Synonyms	Lnhr; CD62L; LAM-1; Ly-22; Lyam1; LECAM1; Ly-m22; Lyam-1; LECAM-1; L-selectin
Calculated MW	42kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane.