제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Mouse CD62L mAb (A26715)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 NIH/3T3 cells (negative control, left) and C57BL/6 mouse splenocytes (right) were surface-stained with PE Rabbit anti-Mouse CD62L mAb (A26715, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CD62L mAb (A26715, 5 μl/Test, right).

Review

Overview

Product name	PE Rabbit anti-Mouse CD62L mAb
Catalog No.	A26715
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC69898-PE

Background

Enables cell adhesion molecule binding activity. Acts upstream of or within response to ATP. Located in external side of plasma membrane. Is expressed in brain; brainstem; submandibular gland epithelium; and testis. Used to study type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in Crohn's disease; IgA glomerulonephritis; and ulcerative colitis. Orthologous to human SELL (selectin L).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 39-332 of mouse CD62L (NP_035476.1).
Sequence	WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYN
Gene ID
Swiss Prot
Synonyms	Lnhr; CD62L; LAM-1; Ly-22; Lyam1; LECAM1; Ly-m22; Lyam-1; LECAM-1; L-selectin
Calculated MW	42kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane.
Customer validation	(Mouse bone marrow)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Mouse CD62L mAb images

Flow CytoMetry - PE Rabbit anti-Mouse CD62L mAb (A26715)

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse CD62L mAb (A26715, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.