제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Mouse IL22 mAb (A27211)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were intracellularly-stained with ABflo® 647 Rabbit anti-Mouse IL22 mAb (A27211, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Mouse IL22 mAb (A27211, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Mouse IL22 mAb
Catalog No.	A27211
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC71491-ABflo647

Background

Enables cytokine activity. Involved in negative regulation of inflammatory response. Acts upstream of or within positive regulation of transcription by RNA polymerase II; reactive oxygen species metabolic process; and regulation of tyrosine phosphorylation of STAT protein. Is active in extracellular space. Is expressed in ileum; retina; and skin. Used to study liposarcoma. Human ortholog(s) of this gene implicated in asthma. Orthologous to human IL22 (interleukin 22).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 34-179 of mouse IL22 (NP_058667.1).
Sequence	LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Gene ID
Swiss Prot
Synonyms	IL-22; If2b1; Iltif; IL-22a; ILTIFa
Calculated MW	20kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Secreted.