제품 > 항체 > 다중클론항체(pAb)

IL22 Rabbit pAb (A23665)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using IL22 Rabbit pAb (A23665) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from CHO cells, using IL22 Rabbit pAb (A23665) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	IL22 Rabbit pAb
Catalog No.	A23665
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable cytokine activity. Acts upstream of or within several processes, including negative regulation of inflammatory response; reactive oxygen species metabolic process; and regulation of tyrosine phosphorylation of STAT protein. Predicted to be located in extracellular space. Is expressed in retina and skin. Used to study liposarcoma. Human ortholog(s) of this gene implicated in asthma. Orthologous to human IL22 (interleukin 22).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 34-179 of mouse IL22. (NP_058667.1).
Sequence	LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Gene ID
Swiss Prot
Synonyms	IL-22; If2b1; Iltif; IL-22a; ILTIFa; IL22
Calculated MW	20kDa
Observed MW	16kDa/18kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Raji, Mouse thymus, CHO-IL22
Cellular location
Customer validation	WB(Mus musculus)